Loading...
Statistics
Advertisement

WeHeartYourArt
www.weheartyourart.com/

Weheartyourart.com

Advertisement
Conversion Technology Metas Server
Weheartyourart.com is hosted in United States / Ashburn . Weheartyourart.com doesn't use HTTPS protocol. Number of used technologies: 5. First technologies: CSS, Html, Html5, Number of used javascripts: 12. First javascripts: Jquery-2.1.0.min.js, Xprs_helper.js, Jquery.mobile.custom.min.js, Number of used analytics tools: 1. First analytics tools: New Relic, Its server type is: squid/3.5.14.

Technologies in use by Weheartyourart.com

Technology

Number of occurences: 5
  • CSS
  • Html
  • Html5
  • Javascript
  • Lightbox

Advertisement

Javascripts

Number of occurences: 12
  • jquery-2.1.0.min.js
  • xprs_helper.js
  • jquery.mobile.custom.min.js
  • flex_arranger.js
  • stripes_arranger.js
  • matrix_arranger.js
  • middle_layout.js
  • multi_layout.js
  • blocks_layout.js
  • menu_layout.js
  • lightbox.js
  • spimeengine.js

Analytics

Number of occurences: 1
  • New Relic

Server Type

  • squid/3.5.14

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Weheartyourart.com

Missing HTTPS protocol.

    Meta - Weheartyourart.com

    Number of occurences: 2
    • Name:
      Content:
    • Name: viewport
      Content: width=device-width, maximum-scale=1

    Server / Hosting

    • IP: 54.225.234.52
    • Latitude: 39.05
    • Longitude: -77.47
    • Country: United States
    • City: Ashburn

    Rname

    • ns52.domaincontrol.com
    • ns51.domaincontrol.com
    • weheartyourart-com.mail.protection.outlook.com

    Target

    • dns.jomax.net

    HTTP Header Response

    HTTP/1.1 403 Forbidden Server: squid/3.5.14 Mime-Version: 1.0 Date: Fri, 15 Jul 2016 00:11:53 GMT Content-Type: text/html;charset=utf-8 Content-Length: 4 X-Squid-Error: ERR_ACCESS_DENIED 0 X-Cache: MISS from s_sr109 X-Cache-Lookup: NONE from s_sr109:80 Via: 1.1 s_sr109 (squid/3.5.14) Connection: keep-alive

    DNS

    host: weheartyourart.com
    1. class: IN
    2. ttl: 600
    3. type: A
    4. ip: 174.129.25.170
    host: weheartyourart.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns52.domaincontrol.com
    host: weheartyourart.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns51.domaincontrol.com
    host: weheartyourart.com
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: ns51.domaincontrol.com
    5. rname: dns.jomax.net
    6. serial: 2016050400
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 600
    host: weheartyourart.com
    1. class: IN
    2. ttl: 600
    3. type: MX
    4. pri: 0
    5. target: weheartyourart-com.mail.protection.outlook.com
    host: weheartyourart.com
    1. class: IN
    2. ttl: 600
    3. type: TXT
    4. txt: MS=ms22413844
    5. entries: Array
    host: weheartyourart.com
    1. class: IN
    2. ttl: 600
    3. type: TXT
    4. txt: v=spf1 include:spf.protection.outlook.com -all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.eheartyourart.com, www.w eheartyourart.com, www. eheartyourart.com, www.wceheartyourart.com, www.ceheartyourart.com, www.weheartyourart.com, www.eheartyourart.com, www.wdeheartyourart.com, www.deheartyourart.com, www.wfeheartyourart.com, www.feheartyourart.com, www.wgeheartyourart.com, www.geheartyourart.com, www.wbeheartyourart.com, www.beheartyourart.com, www.wheartyourart.com, www.wexheartyourart.com, www.wxheartyourart.com, www.wesheartyourart.com, www.wsheartyourart.com, www.wewheartyourart.com, www.wwheartyourart.com, www.werheartyourart.com, www.wrheartyourart.com, www.wefheartyourart.com, www.wfheartyourart.com, www.wevheartyourart.com, www.wvheartyourart.com, www.wecheartyourart.com, www.wcheartyourart.com, www.weqheartyourart.com, www.wqheartyourart.com, www.weaheartyourart.com, www.waheartyourart.com, www.weyheartyourart.com, www.wyheartyourart.com, www.weeartyourart.com, www.weheeartyourart.com, www.weeeartyourart.com, www.wehdeartyourart.com, www.wedeartyourart.com, www.wehceartyourart.com, www.weceartyourart.com, www.wehueartyourart.com, www.weueartyourart.com, www.wehjeartyourart.com, www.wejeartyourart.com, www.weheartyourart.com, www.weeartyourart.com, www.wehbeartyourart.com, www.webeartyourart.com, www.wehgeartyourart.com, www.wegeartyourart.com, www.wehartyourart.com, www.wehexartyourart.com, www.wehxartyourart.com, www.wehesartyourart.com, www.wehsartyourart.com, www.wehewartyourart.com, www.wehwartyourart.com, www.weherartyourart.com, www.wehrartyourart.com, www.wehefartyourart.com, www.wehfartyourart.com, www.wehevartyourart.com, www.wehvartyourart.com, www.wehecartyourart.com, www.wehcartyourart.com, www.weheqartyourart.com, www.wehqartyourart.com, www.weheaartyourart.com, www.wehaartyourart.com, www.weheyartyourart.com, www.wehyartyourart.com, www.wehertyourart.com, www.weheaortyourart.com, www.weheortyourart.com, www.weheaprtyourart.com, www.weheprtyourart.com, www.wehea9rtyourart.com, www.wehe9rtyourart.com, www.weheartyourart.com, www.wehertyourart.com, www.weheairtyourart.com, www.weheirtyourart.com, www.weheaurtyourart.com, www.weheurtyourart.com, www.weheatyourart.com, www.wehearityourart.com, www.weheaityourart.com, www.wehearotyourart.com, www.weheaotyourart.com, www.wehearltyourart.com, www.wehealtyourart.com, www.wehearltyourart.com, www.wehealtyourart.com, www.wehear.tyourart.com, www.wehea.tyourart.com, www.wehearyourart.com, www.weheartqyourart.com, www.wehearqyourart.com, www.weheartayourart.com, www.wehearayourart.com, www.weheart yourart.com, www.wehear yourart.com, www.weheartwyourart.com, www.wehearwyourart.com, www.wehearteyourart.com, www.weheareyourart.com, www.weheartzyourart.com, www.wehearzyourart.com, www.weheartxyourart.com, www.wehearxyourart.com, www.weheartcyourart.com, www.wehearcyourart.com, www.weheartourart.com, www.weheartyzourart.com, www.weheartzourart.com, www.weheartyaourart.com, www.weheartaourart.com, www.weheartysourart.com, www.weheartsourart.com, www.weheartydourart.com, www.weheartdourart.com, www.weheartyourart.com, www.weheartourart.com, www.weheartycourart.com, www.weheartcourart.com, www.wehearty ourart.com, www.weheart ourart.com, www.weheartyurart.com, www.weheartyoburart.com, www.weheartyburart.com, www.weheartyohurart.com, www.weheartyhurart.com, www.weheartyogurart.com, www.weheartygurart.com, www.weheartyojurart.com, www.weheartyjurart.com, www.weheartyomurart.com, www.weheartymurart.com, www.weheartyo urart.com, www.wehearty urart.com, www.weheartyovurart.com, www.weheartyvurart.com, www.weheartyorart.com, www.weheartyouwrart.com, www.weheartyowrart.com, www.weheartyouerart.com, www.weheartyoerart.com, www.weheartyousrart.com, www.weheartyosrart.com, www.weheartyouarart.com, www.weheartyoarart.com, www.weheartyouart.com, www.weheartyouriart.com, www.weheartyouiart.com, www.weheartyouroart.com, www.weheartyouoart.com, www.weheartyourlart.com, www.weheartyoulart.com, www.weheartyourlart.com, www.weheartyoulart.com, www.weheartyour.art.com, www.weheartyou.art.com,

    Other websites we recently analyzed

    1. miscmannamagalginknimatnyasvetchargapoleaz
      San Francisco (United States) - 192.0.78.13
      Server software: nginx
      Technology: Skimlinks, CSS, Gravatar, Html, Html5, Javascript, Php, Pingback, Shortcodes, comScore, Wordpress, Twitter Button
      Number of Javascript: 8
      Number of meta tags: 7
    2. ¿Ã‹Ã‚¡ÍõվȺ ÁªÏµQQ£º1785605588
      Kansas City (United States) - 173.208.215.148
      Server software: Microsoft-IIS/6.0
      Technology: Html
      Number of meta tags: 1
    3. Restaurant La Ripaille
      Le restaurant La Ripaille est situé à Arromanches, nous vous proposons une cuisine Normande traditionnelle.
      France - 213.186.33.104
      G Analytics ID: UA-441859-8
      Server software: Apache
      Technology: Carousel, CSS, Html, Html5, Iframe, Javascript, Google Analytics
      Number of Javascript: 2
      Number of meta tags: 4
    4. Tennessee Career Centers
      Columbia (United States) - 66.211.30.3
      G Analytics ID: UA-39861102-1
      Server software:
      Technology: CSS, Html, Iframe, Javascript, Php, Swf Object, Google Analytics, Facebook Like box
      Number of Javascript: 4
      Number of meta tags: 1
    5. Home | Instant Spark
      Scottsdale (United States) - 173.201.243.1
      Server software: Apache
      Technology: Html
    6. Die Potsdam Lions
      Germany - 212.90.148.98
      Server software: Apache/2.2.31
      Technology: Html, Php
      Number of meta tags: 1
    7. Dorcas Clothing :: Wholesale Clothing
      Dorcas is a fashion wholesaler specializing in women's apparel located in Los Angeles fashion district. We offer the latest fashion at the best quality and price.
      Montréal (Canada) - 184.107.203.99
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery Cycle, jQuery UI, Lightbox, Php
      Number of Javascript: 10
      Number of meta tags: 10
    8. THE NEW MILLIONS
      New York (United States) - 198.185.159.145
      Server software:
      Technology: CSS, Html, Iframe, Javascript, Lightbox, Php, Squarespace
      Number of Javascript: 2
      Number of meta tags: 7
    9. ماشین های اداری امیران
      امیران ماشین
      Iran, Islamic Republic of - 185.8.172.176
      Server software: Apache
      Technology: CSS, Font Awesome, Html, Html5, Javascript, Php, SVG
      Number of Javascript: 4
      Number of meta tags: 3
    10. Corgo Yacht Design
      Corgo Yacht Design sets focus on the creation of motor yachts, our goal is to design a superior yacht that exceeds client expectations.
      Rosario (Argentina) - 179.43.117.66
      Server software: Apache/2.4.20 (Unix) OpenSSL/1.0.1e-fips mod_fastcgi/mod_fastcgi-SNAP-0910052141
      Technology: CSS, Html, Javascript, jQuery Cycle, jQuery Fancybox, jQuery Hover Intent, Php, Google Analytics
      Number of Javascript: 3
      Number of meta tags: 6

    Check Other Websites